PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29717.m000222
Common NameLOC8273025, RCOM_0664190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 575aa    MW: 63467.7 Da    PI: 7.1929
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29717.m000222genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.2e-33232289260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkk+ers  d++++ei+Y+g+Hnh+k
  29717.m000222 232 EDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKIERSL-DGQITEIVYKGSHNHPK 289
                    7****************************************.***************85 PP

2WRKY1061.9e-33407465159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct++ Cpv+k+ver+++d ++v++tYeg+Hnh+
  29717.m000222 407 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPACPVRKHVERASHDLRAVITTYEGKHNHD 465
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-28221290IPR003657WRKY domain
SuperFamilySSF1182906.28E-25226290IPR003657WRKY domain
PROSITE profilePS5081123.33226290IPR003657WRKY domain
SMARTSM007741.3E-35231289IPR003657WRKY domain
PfamPF031064.7E-25232288IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-37392467IPR003657WRKY domain
SuperFamilySSF1182903.66E-29399467IPR003657WRKY domain
PROSITE profilePS5081137.333402467IPR003657WRKY domain
SMARTSM007741.1E-38407466IPR003657WRKY domain
PfamPF031061.7E-25408465IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MASSSGSLDT SANSYPSSFS FSSHSNFMTT TRFTDLLAST DDETIKRSGG LGERIAERTG  60
SGVPKFKSIP PPSLPLSPPS VSPSSYFAIP PGLSPAELLD SPVLLNTSCI LPSPTTGSFA  120
NWKMNSSHNN QQNVKQEDNN YSDFSFQPPT RPCTTSSAMF QSSNSSIQTA QQQRWSLQES  180
VKQDDFGALQ TNTQSSKNNN NNNNNNNNNG FQSDYGDQPQ QYQSVREQRR SEDGYNWRKY  240
GQKQVKGSEN PRSYYKCTYP NCPTKKKIER SLDGQITEIV YKGSHNHPKP QSTRRSSANS  300
SSSATNHATV ENHYSNNIQD QSFGTHGSGG QMDSVVTTPE NSSISVGDDD FDSSQKSKSR  360
SDEYDEDEPE AKRWKTEGEN VGISAPGSRT VREPRVVVQT TSEIDILDDG YRWRKYGQKV  420
VKGNPNPRSY YKCTHPACPV RKHVERASHD LRAVITTYEG KHNHDVPAAR GSHSAVNRPL  480
PDNNNNNNNS NSNSYNSNSS AAMAIRPSAT NYHSTNPIRD SRQPVTSEGE APFSLEMFPS  540
PGSFGFSGFG NAMGSYMNQT KEEPRDDLFL ESLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37223468878Probable WRKY transcription factor 4
2lex_A2e-37223468878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533308.10.0PREDICTED: probable WRKY transcription factor 25
TrEMBLB9T4Y90.0B9T4Y9_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0013s14960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-108WRKY DNA-binding protein 33